PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g40350.2.p
Common NameBRADI_4g40350, MADS2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 254aa    MW: 28231.3 Da    PI: 9.6657
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g40350.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.61.1e-30959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Bradi4g40350.2.p  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
                      79***********************************************95 PP

2K-box99.45.1e-33851741099
             K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       e + ++++qqe+akL+ +i++Lq++++hl+G+++++LslkeL+qLe++Lek++ kiR++Knell  +i+++ k+e elq++n++Lr+k++
  Bradi4g40350.2.p  85 EVNAQQYYQQEAAKLRHQIQMLQNTNKHLVGDSVGNLSLKELKQLESRLEKGIAKIRARKNELLAGEINYMAKREMELQSDNMDLRTKVQ 174
                       567789*********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.27E-32274IPR002100Transcription factor, MADS-box
CDDcd002652.01E-45274No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-323859IPR002100Transcription factor, MADS-box
PfamPF014863.2E-2586173IPR002487Transcription factor, K-box
PROSITE profilePS5129714.65489181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRGRIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
SVKATIDRYK KAHACGSTSG APLIEVNAQQ YYQQEAAKLR HQIQMLQNTN KHLVGDSVGN  120
LSLKELKQLE SRLEKGIAKI RARKNELLAG EINYMAKREM ELQSDNMDLR TKVQIAEGEQ  180
QLQQVTIARP AAVPELNPFA ALDMKCFFPA NLFDAAVQAQ AQAQAQAQAQ ASLQLNLGYQ  240
LAPPGAGDQT HHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-19169169Myocyte-specific enhancer factor 2B
1tqe_R3e-19169169Myocyte-specific enhancer factor 2B
1tqe_S3e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5883220.0HQ588322.1 Brachypodium distachyon MADS-box transcription factor (MADS2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289798.10.0uncharacterized protein LOC100836399
RefseqXP_010238619.10.0PREDICTED: uncharacterized protein LOC100836399 isoform X1
RefseqXP_014757253.10.0PREDICTED: uncharacterized protein LOC100836399 isoform X1
SwissprotQ2QW531e-136MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLG9BIK80.0G9BIK8_BRADI; MADS-box transcription factor
STRINGBRADI4G40350.11e-171(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.18e-86MIKC_MADS family protein